PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG006214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 342aa    MW: 37723.6 Da    PI: 8.2707
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG006214.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-3953112261
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                  +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk++
  CCG006214.1  53 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRV 112
                  7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.3E-3455111IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-2856111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52557111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MLGNCEKMVV ISSTTNEWPQ NQIDEKSLTE STGKLMERPS EEVLSQPQQQ QQQQQALKCP  60
RCDSSNTKFC YYNNYSLSQP RHFCKACKRY WTRGGTLRNV PVGGGCRKNK RVRRPASAVE  120
GANNSVSSAN PNPQTPIDHI SPTSNHFNPL FYGLNSSNPS EMDLPFPGRF NSRVYSAVSG  180
YHDLQPQLNA LALGFSSGIM STNDANGFNP TKQIQDVVTS NSLLSSYSNL FGSSTTSTNT  240
TTPAMASLFA SNFNQQKSTR APNQYQNLTV PFEDLQMSGN SESGVGMKGV KIEHDQNRSN  300
WNVPSQNQID QVGFSDPSMY WNTTNSVGSW HDPANMGSSV LL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1647380.0KT164738.1 Populus tomentosa clone Potom.011G26508 F-box family protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027799.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLB9N3H41e-180B9N3H4_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05450.11e-180(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.15e-38Dof family protein